PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021998-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family NF-YB
Protein Properties Length: 121aa    MW: 13180.9 Da    PI: 5.2184
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021998-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB172.35.3e-5431121292
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                    reqdrflPian+srimkkv+P n+ki+kdak+ vqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl+ yre
  NNU_021998-RA  31 REQDRFLPIANISRIMKKVIPPNGKIAKDAKDCVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIAPLKMYLQLYRE 121
                    89****************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-5028121IPR009072Histone-fold
SuperFamilySSF471136.21E-3833121IPR009072Histone-fold
PfamPF008087.9E-2936100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.7E-206482No hitNo description
PROSITE patternPS0068506783IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006159.7E-2083101No hitNo description
PRINTSPR006159.7E-20102120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MAESGAPGTP ESVHSGEQGG GGAQSGGTGP REQDRFLPIA NISRIMKKVI PPNGKIAKDA  60
KDCVQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM ATLGFEDYIA PLKMYLQLYR  120
E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-4831121393NF-YB
4awl_B3e-4831121494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4831121494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010279615.11e-86PREDICTED: nuclear transcription factor Y subunit B-3-like isoform X3
SwissprotP252095e-59NFYB_MAIZE; Nuclear transcription factor Y subunit B
SwissprotQ9SLG05e-59NFYB1_ARATH; Nuclear transcription factor Y subunit B-1
TrEMBLA9RRZ62e-63A9RRZ6_PHYPA; Predicted protein
TrEMBLA0A0I9QPW37e-63A0A0I9QPW3_PHYPA; CCAAT-box binding factor HAP3-like protein
STRINGPP1S25_89V6.13e-61(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.31e-58nuclear factor Y, subunit B1